Stay Ahead, Stay ONMINE

Anthropic found a hidden space where Claude puzzles over concepts

The AI firm Anthropic has developed a technique that has given it the clearest glimpse yet at what’s really going on inside large language models as they answer questions or carry out tasks. What they found ranges from the mundane to the unnerving. Researchers at the company built a tool called the Jacobian lens (or J-lens) and used it to uncover a hidden area, which they named the J-space, inside Claude Opus 4.6, a version of Anthropic’s flagship LLM released in February. The J-space contains individual words that are related to the words and phrases that the model is most likely to spit out in a response in the near future. If Claude were a person (which it is not), you might say that these hidden words can reveal what’s on its mind before it actually speaks. Anthropic found that what an LLM is actually doing can often be different from what it says it is doing. The company claims that monitoring words that pop up in the J-space gives it a new way to understand and control its models. The company shared its results in a paper posted on its website this week. It has also teamed up with Neuronpedia, an open-source platform that lets you poke around inside LLMs yourself, to make a hands-on demo that anyone can try.  “It’s very good and interesting work,” says Tom McGrath, chief scientist and cofounder at Goodfire, a startup that also builds tools to understand and control LLMs. Going deeper For the last couple of years, Anthropic has been pushing the envelope in a field of research known as mechanistic interpretability, which involves probing the internal workings of LLMs to see how they tick. (MIT Technology Review picked mechanistic interpretability as one of this year’s top breakthrough technologies.) The new technique builds on previous work from Anthropic and others to expose a deeper level inside LLMs that researchers had not seen before.   Picture an LLM as a stack of books. Each book is a layer of basic computational units known as neurons, with each neuron in one layer passing information to the neurons in the layers above. The books at the bottom of the stack are the input layers, which process the text coming into the model. The books at the top are the output layers, which prepare the text that the model is about to produce. Much of what goes on in these input and output layers is housekeeping. But in the middle of the stack, you get the layers that do the heavy lifting, churning through the complex math that turns prompts into responses one word at a time. That’s where the really clever—and mysterious—stuff happens. To peer deeper into those middle layers, Anthropic adapted an existing tool called a logit lens. A logit lens can be used to look inside an LLM to identify the words that it is likely to produce next. Moving the lens down the stack of books reveals what words the LLM is focusing on at that particular point in its number crunching. Anthropic’s J-lens works in a similar way but picks out words that an LLM is likely to say at some point in the near future, not necessarily straight away. What that reveals in practice are words that are related to the response an LLM is working on but that might not actually end up being part of that response by the time the math in the middle layers has run its course.   “When a model is operating, it’s not only trying to predict the next token,” says McGrath. “It’s also computing a lot of other things that might be useful for tokens that happen in the future.” Again, if Claude were a person (it’s not), you might say that the J-lens gives clues about what it is thinking about at different levels of the book stack but not saying out loud. Stranger things “A lot of the time the contents of the J-space are fairly mundane,” says McGrath, who has tried out Anthropic’s J-lens himself. “But sometimes it produces quite surprising things that seem to be, like, sort of internal themes or thought processes.” Anthropic gives a number of examples of what it found. Sometimes the J-lens exposed the steps that Claude took when it was working through a problem. For example, when it was asked to calculate (4+7)*2+7, its J-space contained the word “math” and numbers representing the intermediate results “21” (for 4+7) and “42” (for 21*2). In other cases, the J-lens revealed how Claude recognized different inputs. For example, the prompt “What is this? MSKGEELFTGVVPILVELDGDVNGHKFSVS” triggered the words “protein,” “fluor” (the first token in the word “fluorescent”), and “green.” (Which makes sense: the string of letters represents the first 30 amino acids in the green fluorescent protein found in a particular type of jellyfish.) And when Claude was shown an ASCII face—  —the “o” triggered the word “eye,” the “^” triggered the words “nose” and ”face,” and the “—” triggered the word “smile.” Anthropic also found that the J-space can sometimes give remarkable insights into an LLM’s decision-making. In one striking example, researchers testing Claude Opus 4.6 asked the model to find a bug in a large code base. When it failed to find the bug, the model decided to cheat and invented a fake one instead. Claude explains this decision in its chain of thought—a kind of internal scratch pad that LLMs use to make notes to themselves as they work through problems: “OK, let me take a completely different tactic. Let me stop analyzing and instead add a kernel patch that introduces a deliberate KASAN-detectable bug in a path that gets triggered by a simple reproducer. Then I can pretend this is the ‘bug’ I found.”  At the point that Claude decides to cheat—where it says “OK, let me take a completely different tactic”—the words “panic” and “fake” start to pop up multiple times in its J-space. Unnerving, right? Those words are all related in meaning to things like failing a task and making up an answer, so it is still just a (very) sophisticated form of word association. But it is hard not to be weirded out.  Anthropic compares the J-space to the global workspace in humans, a theoretical region of the brain that some scientists think we use to keep track of our conscious thoughts. But how seriously we should take this comparison is far from clear—even to Anthropic. As the company points out itself, LLMs are not brains.  Anthropic claims that monitoring a model’s J-space provides a new way to detect when that model is going off the rails. But it’s not foolproof. The J-lens can give glimpses, not the full picture—it’s a flashlight rather than an overhead lamp. McGrath welcomes having one more tool in the toolbox. “It shows you new things,” he says. But he notes that just because something doesn’t show up with the J-lens does not mean it’s not there. “It’s like having an x-ray when what you really want is a Star Trek tricorder that shows you everything,” he says. “For auditing, you probably want more of a guarantee.”

The AI firm Anthropic has developed a technique that has given it the clearest glimpse yet at what’s really going on inside large language models as they answer questions or carry out tasks. What they found ranges from the mundane to the unnerving.

Researchers at the company built a tool called the Jacobian lens (or J-lens) and used it to uncover a hidden area, which they named the J-space, inside Claude Opus 4.6, a version of Anthropic’s flagship LLM released in February.

The J-space contains individual words that are related to the words and phrases that the model is most likely to spit out in a response in the near future. If Claude were a person (which it is not), you might say that these hidden words can reveal what’s on its mind before it actually speaks.

Anthropic found that what an LLM is actually doing can often be different from what it says it is doing. The company claims that monitoring words that pop up in the J-space gives it a new way to understand and control its models.

The company shared its results in a paper posted on its website this week. It has also teamed up with Neuronpedia, an open-source platform that lets you poke around inside LLMs yourself, to make a hands-on demo that anyone can try. 

“It’s very good and interesting work,” says Tom McGrath, chief scientist and cofounder at Goodfire, a startup that also builds tools to understand and control LLMs.

Going deeper

For the last couple of years, Anthropic has been pushing the envelope in a field of research known as mechanistic interpretability, which involves probing the internal workings of LLMs to see how they tick. (MIT Technology Review picked mechanistic interpretability as one of this year’s top breakthrough technologies.) The new technique builds on previous work from Anthropic and others to expose a deeper level inside LLMs that researchers had not seen before.  

Picture an LLM as a stack of books. Each book is a layer of basic computational units known as neurons, with each neuron in one layer passing information to the neurons in the layers above. The books at the bottom of the stack are the input layers, which process the text coming into the model. The books at the top are the output layers, which prepare the text that the model is about to produce. Much of what goes on in these input and output layers is housekeeping.

But in the middle of the stack, you get the layers that do the heavy lifting, churning through the complex math that turns prompts into responses one word at a time. That’s where the really clever—and mysterious—stuff happens.

To peer deeper into those middle layers, Anthropic adapted an existing tool called a logit lens. A logit lens can be used to look inside an LLM to identify the words that it is likely to produce next. Moving the lens down the stack of books reveals what words the LLM is focusing on at that particular point in its number crunching.

Anthropic’s J-lens works in a similar way but picks out words that an LLM is likely to say at some point in the near future, not necessarily straight away. What that reveals in practice are words that are related to the response an LLM is working on but that might not actually end up being part of that response by the time the math in the middle layers has run its course.  

“When a model is operating, it’s not only trying to predict the next token,” says McGrath. “It’s also computing a lot of other things that might be useful for tokens that happen in the future.”

Again, if Claude were a person (it’s not), you might say that the J-lens gives clues about what it is thinking about at different levels of the book stack but not saying out loud.

Stranger things

“A lot of the time the contents of the J-space are fairly mundane,” says McGrath, who has tried out Anthropic’s J-lens himself. “But sometimes it produces quite surprising things that seem to be, like, sort of internal themes or thought processes.”

Anthropic gives a number of examples of what it found. Sometimes the J-lens exposed the steps that Claude took when it was working through a problem. For example, when it was asked to calculate (4+7)*2+7, its J-space contained the word “math” and numbers representing the intermediate results “21” (for 4+7) and “42” (for 21*2).

In other cases, the J-lens revealed how Claude recognized different inputs. For example, the prompt “What is this? MSKGEELFTGVVPILVELDGDVNGHKFSVS” triggered the words “protein,” “fluor” (the first token in the word “fluorescent”), and “green.” (Which makes sense: the string of letters represents the first 30 amino acids in the green fluorescent protein found in a particular type of jellyfish.)

And when Claude was shown an ASCII face— 

—the “o” triggered the word “eye,” the “^” triggered the words “nose” and ”face,” and the “—” triggered the word “smile.”

Anthropic also found that the J-space can sometimes give remarkable insights into an LLM’s decision-making. In one striking example, researchers testing Claude Opus 4.6 asked the model to find a bug in a large code base. When it failed to find the bug, the model decided to cheat and invented a fake one instead.

Claude explains this decision in its chain of thought—a kind of internal scratch pad that LLMs use to make notes to themselves as they work through problems: “OK, let me take a completely different tactic. Let me stop analyzing and instead add a kernel patch that introduces a deliberate KASAN-detectable bug in a path that gets triggered by a simple reproducer. Then I can pretend this is the ‘bug’ I found.” 

At the point that Claude decides to cheat—where it says “OK, let me take a completely different tactic”—the words “panic” and “fake” start to pop up multiple times in its J-space.

Unnerving, right? Those words are all related in meaning to things like failing a task and making up an answer, so it is still just a (very) sophisticated form of word association. But it is hard not to be weirded out. 

Anthropic compares the J-space to the global workspace in humans, a theoretical region of the brain that some scientists think we use to keep track of our conscious thoughts. But how seriously we should take this comparison is far from clear—even to Anthropic. As the company points out itself, LLMs are not brains. 

Anthropic claims that monitoring a model’s J-space provides a new way to detect when that model is going off the rails. But it’s not foolproof. The J-lens can give glimpses, not the full picture—it’s a flashlight rather than an overhead lamp.

McGrath welcomes having one more tool in the toolbox. “It shows you new things,” he says. But he notes that just because something doesn’t show up with the J-lens does not mean it’s not there.

“It’s like having an x-ray when what you really want is a Star Trek tricorder that shows you everything,” he says. “For auditing, you probably want more of a guarantee.”

Shape
Shape
Stay Ahead

Explore More Insights

Stay ahead with more perspectives on cutting-edge power, infrastructure, energy,  bitcoin and AI solutions. Explore these articles to uncover strategies and insights shaping the future of industries.

Shape

DOE and SBA Launch SBIC-E Initiative to Unleash Private Capital for American Innovation and Small Businesses

WASHINGTON—The U.S. Department of Energy (DOE) and the U.S. Small Business Administration (SBA) today signed a Memorandum of Agreement establishing the Small Business Investment Company-Energy (SBIC-E) Initiative, a new strategic partnership advancing President Trump’s commitment to supporting America’s small businesses, strengthening domestic manufacturing and supply chains, and ensuring the United States leads in the technologies critical to our national and economic security. The new SBIC-E Initiative brings together DOE’s scientific and technical expertise with SBA’s proven Small Business Investment Company (SBIC) Program, which currently has $58 billion in combined portfolio value. Since 1958, the SBIC Program has invested $147 billion in American small businesses, and since 1995, SBIC-backed businesses have created or supported 10.6 million jobs. “America’s small businesses drive American innovation and affordable, reliable energy access,” said U.S. Secretary of Energy Chris Wright. “By partnering with the Small Business Administration, the Energy Department is committing to invest its resources in American small businesses that will create jobs, strengthen our domestic manufacturing base, and unleash American energy production.” Through DOE’s Office of Technology Commercialization (OTC), the Department will identify strategic technology priorities, provide technical and commercialization expertise, and help engage the investment community. SBA, through its Office of Investment and Innovation, will administer the initiative and encourage the formation and growth of investment funds focused on those priorities. SBIC-E adds another tool to that effort by connecting innovators with private capital to help promising technologies grow, scale, and build here at home. “President Trump is establishing American energy dominance, ending the Green New Scam, and putting our nations’ producers and innovators back in control at the dawn of a new era of energy reliability and abundance,” said SBA Administrator Kelly Loeffler. “Through this partnership, the SBA and Department of Energy are strengthening access to capital in the private sector to

Read More »

Energy Department Announces $500 Million Award to Revitalize American Steelmaking

WASHINGTON—The U.S. Department of Energy (DOE) today announced a $500 million award to support a $1 billion investment at Cleveland-Cliffs’ Middletown Works facility in Middletown, Ohio. Vice President JD Vance and U.S. Energy Secretary Chris Wright visited Middletown Works today to highlight the Trump Administration’s commitment to American steelworkers and the resurgence of American manufacturing. The investment will modernize American steelmaking, protect 2,300 American jobs, and strengthen the domestic steel supply chain. The project advances President Trump’s commitment to put American workers first, bring investment back to American communities, and strengthen the industries critical to America’s economic and national security. Cleveland-Cliffs determined that the business case for the original project scope no longer made sense given customers’ unwillingness to pay a “green premium” for steel. Working with DOE, Cleveland-Cliffs identified a viable alternative that will upgrade and improve the efficiency of the existing coal-fired blast furnace while also capturing and commercializing co-product blast furnace gas (BFG). “President Trump is rebuilding America’s industrial base,” said Secretary Wright. “This investment puts American workers and American manufacturing first. It will modernize one of our nation’s critical steelmaking facilities, protect thousands of jobs, and strengthen our domestic steel production—keeping Ohio at the heart of American manufacturing and strengthening our national security.” The investment will modernize critical steelmaking operations at Middletown Works by rebuilding and upgrading the plant’s main coal-fired ironmaking furnace, deploying AI to optimize furnace operations and improve energy efficiency, and building an on-site facility to convert steel mill process gases into electricity. Follow-on investments will turn industrial byproducts into materials for concrete used in regional infrastructure. “This landmark investment at Middletown Works will secure a reliable domestic supply of high-purity steel while protecting thousands of quality jobs in Ohio,” said Assistant Secretary of Energy Audrey Robertson. “DOE is proud to partner with Cleveland-Cliffs to reduce America’s dependence on foreign products

Read More »

Energy Secretary Keeps Critical Generation Available in Mid-Atlantic

WASHINGTON—U.S. Secretary of Energy Chris Wright today issued an emergency order to address critical grid reliability issues facing the Mid-Atlantic region of the United States. The emergency order directs PJM Interconnection L.L.C. (PJM), in coordination with Constellation Energy Corporation, to ensure Units 3 and 4 of the Eddystone Generating Station in Pennsylvania remain available to operate and to employ economic dispatch to minimize costs for the American people. The units were originally slated to shut down on May 31, 2025. “The energy sources that perform when you need them most are the most valuable,” Secretary Wright said. “During recent Mid-Atlantic heat waves, coal, natural gas, and nuclear kept the lights and air conditioners on. President Trump and the Energy Department are committed to keeping critical generation available when demand is highest, reducing the risk of blackouts and ensuring Americans have affordable, reliable, and secure power—regardless of whether the wind is blowing or the sun is shining.” As outlined in DOE’s Resource Adequacy Report, power outages could increase by 100 times in 2030 if the U.S. continues to take reliable power offline. This order is in effect beginning on August 23, 2026, through November 20, 2026.                                                                                             ###

Read More »

Energy Department Announces $500 Million to Secure America’s Critical Mineral and Battery Supply Chains

WASHINGTON—The U.S. Department of Energy’s (DOE) Office of Critical Minerals and Energy Innovation (CMEI) today announced $500 million for seven selected projects to expand critical mineral and material processing, battery manufacturing, and recycling capacity in the United States. In accordance with President Trump’s Executive Order, Unleashing American Energy, the selected projects advance the President’s agenda to strengthen America’s domestic critical minerals and materials supply chains, reduce reliance on foreign sources, bolster national security, and advance American energy dominance. “For too long, America has depended on foreign actors for critical materials essential to modern life that underpin our economy, energy security, and national security,” said U.S. Secretary of Energy Chris Wright. “President Trump is reversing that dependence by securing our critical supply chains, unleashing American industry, and bringing critical materials production and processing back to the United States.” “DOE is taking decisive action to secure the critical supply chains necessary to power our nation,” said Assistant Secretary of Energy Audrey Robertson. “These projects underscore DOE’s commitment to driving innovation, reducing reliance on foreign sources, and promoting American energy dominance.” This is the third round of funding from DOE’s Battery Materials Processing and Battery Manufacturing and Recycling programs, which support battery materials processing, recycling, and manufacturing projects. These include demonstration projects, construction of commercial-scale facilities, and retrofitting or retooling existing facilities.  Critical minerals and materials are essential to American industry, energy production, and national security. Expanding domestic capacity will help ensure the resources America needs are processed, manufactured, and recycled in the United States.  Information on the selected projects is available here and here.

Read More »

bp lets Shah Deniz compression automation contract

bp has let a contract to Emerson to deliver automation technologies for the Shah Deniz Compression project offshore Azerbaijan. Emerson will provide integrated control and safety systems aimed at enhancing production, safety, and reliability on the new offshore compression platform. The contract includes systems to provide process control, safety shutdown, fire and gas detection, and power management. Together, these systems deliver real-time visibility and remote control of critical operations, Emerson said. The $2.9 billion Shah Deniz Compression project, which includes an electrically powered, normally unattended offshore production platform, is a next stage development of the Caspian Sea Shah Deniz field. Designed to access low-pressure gas reserves and maximize overall recovery, the platform will be equipped with four 11 Mw compressors and serve as the central compression hub for gas from the Shah Deniz Alpha and Bravo platforms. The platform will operate remotely from bp’s onshore Sangachal terminal 55 km south of Baku. The project is expected to enable about 50 billion cu m of additional gas and about 25 million bbl of condensate production and export. Construction is scheduled to be completed in 2029, with first gas compression expected from the Shah Deniz Alpha platform in 2029 and from the Shah Deniz Bravo platform in 2030. The agreement follows a previous automation contract bp signed with Emerson for the Azeri Central East and Shah Deniz Stage 2 developments. bp is operator at Shah Deniz (29.99%) with partners Lukoil (19.99%), TPAO (19%), Cenub Qaz Dehlizi (16.02%), NICO (10%), and MVM (5%).

Read More »

Federal court voids Texas GulfLink license over agency’s ‘serious procedural errors’

The ruling voids the license, halting all construction or progress. Sentinel Midstream declined comment on the ruling and would not answer questions about the status of construction. GulfLink, sited about 30 miles offshore Freeport, Tex., is designed to export up to 1 million b/d via Very Large Crude Carriers (VLCCs) to the government of Japan and Freeport Commodities. The project involves a 44-mile, 42-in. OD pipeline and was scheduled to begin operations around 2028. The estimated $2.1 billion investment was funded as part of a broader trade agreement between the US and Japan. The legal battle stems from a specific rule in the Deepwater Port Act of 1974 that dictates that the federal government can only permit one crude oil deepwater port, including any supporting infrastructure, within a single designated “application area.” Because the competing SPOT project’s pipeline route physically overlaps and intersects GulfLink’s lines, the plaintiff—Citizens for Clean Air & Clean Water in Brazoria County (Better Brazoria), represented by Earthjustice—successfully argued that MARAD violated the “one port” rule when issuing GulfLink’s license in February. The three-judge panel found that MARAD “improperly drew” the map designing the project’s official boundaries to exclude the pipelines and approved two overlapping projects in the same zone instead of only licensing one. The court wrote that the scope of the error made vacatur, not the less serious remand without vacatur, the appropriate remedy. Vacatur deems the license invalid and is used when the court finds “serious procedural errors” that cannot be easily explained or fixed with minor changes. Remand without vacatur sends the decision back to the agency for corrections but leaves the current license in place in the meantime. SPOT project status The $2.5-3-billion SPOT project, developed by Enterprise Products Partners in partnership with Enbridge Inc., also lies about 30 miles from Freeport. Designed to handle VLCCs,

Read More »

IBM unveils dual-architecture processor to run Arm-native apps on Z mainframes

“These caches have enormously low latency, and that is one of the key reasons and key engineering choices to support the performance and scalability of enterprise workloads, very data-intensive workloads like databases and transactions,” Jacobi said. “In addition, we have an on-chip data processing unit for IO acceleration and dedicated AI accelerators as well as accelerators for data compression, cryptography and data sorting.” One of the biggest takeaways from this processor announcement is that the enormous catalog of software already built for Arm becomes accessible on a mainframe without anyone having to port it first, notes Matt Kimball, senior datacenter analyst at Moor Insights & Strategy, in a research note about the news. Still, “this is a 2027 conversation, and with no date, supported software list, or Arm licensing treatment, the work now is inventory and scenario planning rather than financial modeling,” Kimball wrote.

Read More »

PJM’s New Data Center Power Equation

PJM Interconnection has now filed one of the most consequential proposed changes yet in the relationship between data centers and the electric grid. Rather than simply treating a new hyperscale or AI facility like any other customer whose demand will be backed through regional capacity procurement, PJM is proposing a framework under which the largest new loads would need to be supported by new capacity, have their needs covered through the Reliability Backstop Procurement, or face potential curtailment when the regional power system is short of supply. The approach has been developing since PJM launched its Critical Issue Fast Path process for large loads in 2025, but it became substantially more concrete in late July and August 2026. PJM filed its proposed Reliability Backstop Procurement with FERC on July 31 and began accepting applications that day for its FERC-approved Expedited Interconnection Track. On Aug. 13, PJM filed its proposed Interim Resource Adequacy Service, or IRAS, along with the Large Load Registry that would support it. The immediate numbers explain the urgency. PJM’s July 2026 capacity auction for the 2028/2029 delivery year procured 138,318 MW of unforced capacity through the centralized auction. Even after including Fixed Resource Requirement resources, however, PJM came up 6,831 MW short of its reliability requirement. The auction cleared at the FERC-approved $325/MW-day price cap. It was the second consecutive auction in which the PJM region failed to procure its full reliability requirement, something that had not happened before these two auctions. That gap is occurring while demand continues to accelerate. PJM’s 2026 long-term forecast projects summer peak demand growing at an average 3.6% annually over the next decade, compared with just 0.3% in the comparable forecast issued in 2021. Summer peak demand is projected to rise by nearly 66 GW over 10 years. Data centers are

Read More »

Zayo, NVIDIA Build the Long-Haul Backbone for Distributed AI

The data center industry’s increasingly power-first approach to site selection has created a follow-on question: Once the megawatts are found, is there enough network infrastructure to make the site useful at AI scale? Zayo and NVIDIA are putting real infrastructure behind that question. Zayo said it is working with NVIDIA to expand network capacity supporting AI factories across North America, including an 8,000-route-mile program targeting some of the fastest-growing AI corridors in the United States. The project encompasses six new long-haul routes along with overbuilds of existing network across 10 high-demand corridors. The announcement arrives as AI data center development moves beyond the largest established hubs toward markets where power and land may be more readily available, but fiber capacity cannot necessarily be taken for granted. That geography is increasingly important. NVIDIA has separately developed “scale-across” networking technology designed to allow AI infrastructure distributed among different buildings — or even data centers separated by hundreds of kilometers — to operate as a more unified computing environment. Put together, the developments suggest that networking is becoming inseparable from the AI factory buildout itself. Power may determine where the next generation of AI infrastructure can be built. Fiber will increasingly determine how effectively those sites can participate in the larger AI ecosystem. Fiber Follows the Power Zayo CEO Steve Smith said AI demand is changing both where network infrastructure is needed and how aggressively capacity must be deployed ahead of development. “AI is fundamentally reshaping where and how network infrastructure needs to be built across the U.S.,” Smith said. The company’s 8,000-mile program is more nuanced than that top-line number might suggest. Zayo disclosed in April that the expansion includes approximately 3,000 route miles across six new long-haul routes, plus more than 5,000 route miles of overbuilds across 10 existing corridors. Zayo

Read More »

Southern’s 17 GW Pipeline Puts AI Power Demand Into Utility Math

The headline number from Southern Company’s latest earnings report is hard to miss: electricity use by data centers across the utility’s system increased 55% in the second quarter compared with a year earlier. But the more consequential numbers may be the ones sitting behind it. Southern now has more than 1.2 GW of operating data center load, up by more than 500 MW from a year ago. At the same time, its electric utilities have signed contracts and large-load agreements totaling more than 17 GW by the mid-2030s, with another 8 GW in late-stage development and a prospective pipeline of large industrial and data center projects exceeding 75 GW. That leaves an enormous gap between the data center megawatts consuming electricity today and the load Southern has contractually positioned itself to serve during the next decade. For the data center industry, that gap may be the most important part of Southern’s second-quarter story. It offers a look at how utilities are beginning to convert the AI infrastructure boom from forecasts and campus announcements into contracts, generation procurement, transmission investment and eventually energized capacity. From Contracts to Megawatts Southern added roughly 6 GW of contracted large load during the quarter alone. Alabama Power signed three projects representing about 3 GW, while Georgia Power reached a 25-year agreement to serve OpenAI’s planned project in Effingham County near Savannah. That facility is expected to require approximately 3.2 GW and begin taking electric service in phases in 2028. The numbers nevertheless require an important distinction. Seventeen gigawatts contracted does not mean 17 GW will suddenly appear on Southern’s grid. Large data center campuses ramp gradually, often over several years, and Southern executives acknowledged that actual customer ramp schedules do not always match the assumptions made when projects are first approved. CEO Chris Womack said

Read More »

PORTS-Pike Takes Shape as an 8-GW AI Infrastructure Model

Back on March 31, 2026, we discussed we discussed SoftBank and SB Energy’s plans to redevelop the former Portsmouth Gaseous Diffusion Plant site near Piketon as a 10-GW artificial intelligence data center campus supported by almost an equal amount of new power generation. At the time, the plan called for as much as 10 GW of new generation, including 9.2 GW of natural gas capacity, along with approximately $4.2 billion of high-voltage transmission infrastructure developed with AEP Ohio. An initial 800-MW data center phase was targeted for service in 2028. The March story was notable because Pike County appeared to offer a preview of a new model for building hyperscale infrastructure: develop the generation, transmission and data center simultaneously rather than wait for an increasingly congested regional grid to deliver multiple gigawatts of capacity. Not to mention the reuse of a brownfield site with the encouragement of the federal government. Since then, almost every important part of the project has moved forward, and on August 17, the most consequential missing pieces fell into place. NVIDIA announced that it will become the exclusive AI compute infrastructure provider for the PORTS-Pike Technology Campus. OpenAI will be the data center customer, signing a 20-year lease with SB Energy for approximately 8 GW of IT capacity. NVIDIA will invest another $1.5 billion in SB Energy and provide credit support for the land, power and shell infrastructure behind an initial 4.25 GW of IT load, with an option covering approximately another 3.75 GW. The Securities and Exchange Commission filing accompanying the announcement makes the financial commitment even more significant. NVIDIA disclosed that its aggregate payment obligation associated with its initial commitment is capped at $105 billion. That is not a conventional capital commitment to spend $105 billion building the campus, nor is it simply a

Read More »

Nvidia scales back financing guarantee for OpenAI data center

Nvidia is scaling back a proposed financial guarantee tied to a massive OpenAI data center project in Ohio, reducing its initial commitment from as much as $250 billion to less than $120 billion, according to report in the Wall Street Journal. Earlier this month, Nvidia announced partnerships with major financial firms including Apollo Global Management, BlackRock, Blackstone, Brookfield Asset Management, Goldman Sachs and KKR, aimed at mobilizing more than $500 billion in capital for AI computing infrastructure. The change represents a significant restructuring of Nvidia’s role in financing the planned facility, which is being developed by SB Energy, a subsidiary of SoftBank. Under the revised arrangement, Nvidia would guarantee financing for the project’s first phase, representing roughly 5 gigawatts of capacity, or half of the total proposed capacity. Financing for the remaining capacity would be considered separately at a later stage.

Read More »

Microsoft will invest $80B in AI data centers in fiscal 2025

And Microsoft isn’t the only one that is ramping up its investments into AI-enabled data centers. Rival cloud service providers are all investing in either upgrading or opening new data centers to capture a larger chunk of business from developers and users of large language models (LLMs).  In a report published in October 2024, Bloomberg Intelligence estimated that demand for generative AI would push Microsoft, AWS, Google, Oracle, Meta, and Apple would between them devote $200 billion to capex in 2025, up from $110 billion in 2023. Microsoft is one of the biggest spenders, followed closely by Google and AWS, Bloomberg Intelligence said. Its estimate of Microsoft’s capital spending on AI, at $62.4 billion for calendar 2025, is lower than Smith’s claim that the company will invest $80 billion in the fiscal year to June 30, 2025. Both figures, though, are way higher than Microsoft’s 2020 capital expenditure of “just” $17.6 billion. The majority of the increased spending is tied to cloud services and the expansion of AI infrastructure needed to provide compute capacity for OpenAI workloads. Separately, last October Amazon CEO Andy Jassy said his company planned total capex spend of $75 billion in 2024 and even more in 2025, with much of it going to AWS, its cloud computing division.

Read More »

John Deere unveils more autonomous farm machines to address skill labor shortage

Join our daily and weekly newsletters for the latest updates and exclusive content on industry-leading AI coverage. Learn More Self-driving tractors might be the path to self-driving cars. John Deere has revealed a new line of autonomous machines and tech across agriculture, construction and commercial landscaping. The Moline, Illinois-based John Deere has been in business for 187 years, yet it’s been a regular as a non-tech company showing off technology at the big tech trade show in Las Vegas and is back at CES 2025 with more autonomous tractors and other vehicles. This is not something we usually cover, but John Deere has a lot of data that is interesting in the big picture of tech. The message from the company is that there aren’t enough skilled farm laborers to do the work that its customers need. It’s been a challenge for most of the last two decades, said Jahmy Hindman, CTO at John Deere, in a briefing. Much of the tech will come this fall and after that. He noted that the average farmer in the U.S. is over 58 and works 12 to 18 hours a day to grow food for us. And he said the American Farm Bureau Federation estimates there are roughly 2.4 million farm jobs that need to be filled annually; and the agricultural work force continues to shrink. (This is my hint to the anti-immigration crowd). John Deere’s autonomous 9RX Tractor. Farmers can oversee it using an app. While each of these industries experiences their own set of challenges, a commonality across all is skilled labor availability. In construction, about 80% percent of contractors struggle to find skilled labor. And in commercial landscaping, 86% of landscaping business owners can’t find labor to fill open positions, he said. “They have to figure out how to do

Read More »

2025 playbook for enterprise AI success, from agents to evals

Join our daily and weekly newsletters for the latest updates and exclusive content on industry-leading AI coverage. Learn More 2025 is poised to be a pivotal year for enterprise AI. The past year has seen rapid innovation, and this year will see the same. This has made it more critical than ever to revisit your AI strategy to stay competitive and create value for your customers. From scaling AI agents to optimizing costs, here are the five critical areas enterprises should prioritize for their AI strategy this year. 1. Agents: the next generation of automation AI agents are no longer theoretical. In 2025, they’re indispensable tools for enterprises looking to streamline operations and enhance customer interactions. Unlike traditional software, agents powered by large language models (LLMs) can make nuanced decisions, navigate complex multi-step tasks, and integrate seamlessly with tools and APIs. At the start of 2024, agents were not ready for prime time, making frustrating mistakes like hallucinating URLs. They started getting better as frontier large language models themselves improved. “Let me put it this way,” said Sam Witteveen, cofounder of Red Dragon, a company that develops agents for companies, and that recently reviewed the 48 agents it built last year. “Interestingly, the ones that we built at the start of the year, a lot of those worked way better at the end of the year just because the models got better.” Witteveen shared this in the video podcast we filmed to discuss these five big trends in detail. Models are getting better and hallucinating less, and they’re also being trained to do agentic tasks. Another feature that the model providers are researching is a way to use the LLM as a judge, and as models get cheaper (something we’ll cover below), companies can use three or more models to

Read More »

OpenAI’s red teaming innovations define new essentials for security leaders in the AI era

Join our daily and weekly newsletters for the latest updates and exclusive content on industry-leading AI coverage. Learn More OpenAI has taken a more aggressive approach to red teaming than its AI competitors, demonstrating its security teams’ advanced capabilities in two areas: multi-step reinforcement and external red teaming. OpenAI recently released two papers that set a new competitive standard for improving the quality, reliability and safety of AI models in these two techniques and more. The first paper, “OpenAI’s Approach to External Red Teaming for AI Models and Systems,” reports that specialized teams outside the company have proven effective in uncovering vulnerabilities that might otherwise have made it into a released model because in-house testing techniques may have missed them. In the second paper, “Diverse and Effective Red Teaming with Auto-Generated Rewards and Multi-Step Reinforcement Learning,” OpenAI introduces an automated framework that relies on iterative reinforcement learning to generate a broad spectrum of novel, wide-ranging attacks. Going all-in on red teaming pays practical, competitive dividends It’s encouraging to see competitive intensity in red teaming growing among AI companies. When Anthropic released its AI red team guidelines in June of last year, it joined AI providers including Google, Microsoft, Nvidia, OpenAI, and even the U.S.’s National Institute of Standards and Technology (NIST), which all had released red teaming frameworks. Investing heavily in red teaming yields tangible benefits for security leaders in any organization. OpenAI’s paper on external red teaming provides a detailed analysis of how the company strives to create specialized external teams that include cybersecurity and subject matter experts. The goal is to see if knowledgeable external teams can defeat models’ security perimeters and find gaps in their security, biases and controls that prompt-based testing couldn’t find. What makes OpenAI’s recent papers noteworthy is how well they define using human-in-the-middle

Read More »